Lineage for d1r2ma_ (1r2m A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383566Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 383567Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) (S)
  5. 383568Family b.138.1.1: Hydrophobin II, HfbII [101752] (1 protein)
    a self-assembling amphiphile
  6. 383569Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 383570Species Trichoderma reesei [TaxId:51453] [101754] (1 PDB entry)
  8. 383571Domain d1r2ma_: 1r2m A: [96871]

Details for d1r2ma_

PDB Entry: 1r2m (more details), 1 Å

PDB Description: Atomic resolution structure of the HFBII hydrophobin: a self-assembling amphiphile

SCOP Domain Sequences for d1r2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ma_ b.138.1.1 (A:) Hydrophobin II, HfbII {Trichoderma reesei}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

SCOP Domain Coordinates for d1r2ma_:

Click to download the PDB-style file with coordinates for d1r2ma_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ma_: