SCOPe 2.08: Domain d1r2ma_: 1r2m A:

Lineage for d1r2ma_ (1r2m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
   core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection

4. Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families)
   automatically mapped to Pfam PF06766

5. Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
   a self-assembling amphiphile

6. Protein Hydrophobin II, HfbII [101753] (1 species)

7. Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)

8. Domain d1r2ma_: 1r2m A: [96871]
   complexed with mn

Details for d1r2ma_

PDB Entry: 1r2m, 1 Å

PDB Description: Atomic resolution structure of the HFBII hydrophobin: a self-assembling amphiphile

PDB Compounds: (A:) Hydrophobin II

SCOPe Domain Sequences for d1r2ma_:

Sequence; same for both SEQRES and ATOM records:

>d1r2ma_ b.138.1.1 (A:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

Timeline for d1r2ma_:

• d1r2ma_ first appeared in SCOP 1.67
  
• d1r2ma_ appears in SCOPe 2.07