Lineage for d1r2ja2 (1r2j A:3-212)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691657Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1691740Protein Protein FkbI [103396] (1 species)
    involved in biosynthesis of methoxymalonyl extender unit of fk520 polyketide immunosuppressant
  7. 1691741Species Streptomyces hygroscopicus [TaxId:1912] [103397] (1 PDB entry)
  8. 1691742Domain d1r2ja2: 1r2j A:3-212 [96870]
    Other proteins in same PDB: d1r2ja1
    complexed with fad

Details for d1r2ja2

PDB Entry: 1r2j (more details), 2.1 Å

PDB Description: fkbi for biosynthesis of methoxymalonyl extender unit of fk520 polyketide immunosuppresant
PDB Compounds: (A:) protein FkbI

SCOPe Domain Sequences for d1r2ja2:

Sequence, based on SEQRES records: (download)

>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]}
erdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengefta
hvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsgklaavgfserqagsdlsa
mrtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrvervpk
psgcraaghadlhldqvrvpagavlagsga

Sequence, based on observed residues (ATOM records): (download)

>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]}
erdalltdlvgdraaewdtsgelprdllvrlgadgllcaevaaehgglglgsrengefta
hvgslcsslrsvmtsqgmaawtvqrlgdagqratflkeltsglaavgfserqagsdlsam
rtrvrldgdtavvdghkvwttaaayadhlvvfglqedgsgavvvvpadtpgvrvervpkp
sgcraaghadlhldqvrvpagavlagsga

SCOPe Domain Coordinates for d1r2ja2:

Click to download the PDB-style file with coordinates for d1r2ja2.
(The format of our PDB-style files is described here.)

Timeline for d1r2ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2ja1