Lineage for d1r2ja1 (1r2j A:213-365)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639872Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 639873Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)
  6. 639959Protein Protein FkbI [101146] (1 species)
    involved in biosynthesis of methoxymalonyl extender unit of fk520 polyketide immunosuppressant
  7. 639960Species Streptomyces hygroscopicus [TaxId:1912] [101147] (1 PDB entry)
  8. 639961Domain d1r2ja1: 1r2j A:213-365 [96869]
    Other proteins in same PDB: d1r2ja2
    complexed with fad

Details for d1r2ja1

PDB Entry: 1r2j (more details), 2.1 Å

PDB Description: fkbi for biosynthesis of methoxymalonyl extender unit of fk520 polyketide immunosuppresant
PDB Compounds: (A:) protein FkbI

SCOP Domain Sequences for d1r2ja1:

Sequence, based on SEQRES records: (download)

>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]}
slpmlvaaslaygrksvawgcvgilracrtaavahartreqfgrplgdhqlvaghiadlw
taeqiaarvceyasdhwdegspemvpatilakhvaaeraaagaataaqvlasagareghv
verayrdaklmeiiegssemcrvmlaqhalalp

Sequence, based on observed residues (ATOM records): (download)

>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]}
slpmlvaaslaygrksvawgcvgilracrtaavahartreqfgrplgdhqlvaghiadlw
taeqiaarvceyasdhmvpatilakhvaaeraaagaataaqvlasagaghvverayrdak
lmeiiegssemcrvmlaqhalalp

SCOP Domain Coordinates for d1r2ja1:

Click to download the PDB-style file with coordinates for d1r2ja1.
(The format of our PDB-style files is described here.)

Timeline for d1r2ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2ja2