Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries) synonym: blastochloris viridis |
Domain d1r2ch2: 1r2c H:1-36 [96861] Other proteins in same PDB: d1r2cc_, d1r2ch1, d1r2cl_, d1r2cm_ complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2 |
PDB Entry: 1r2c (more details), 2.86 Å
SCOPe Domain Sequences for d1r2ch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d1r2ch2: