SCOP 1.71: Domain d1r2ba_: 1r2b A:

Lineage for d1r2ba_ (1r2b A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (2 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries)

8. Domain d1r2ba_: 1r2b A: [96857]

Details for d1r2ba_

PDB Entry: 1r2b, 2.2 Å

PDB Description: crystal structure of the bcl6 btb domain complexed with a smrt co- repressor peptide

SCOP Domain Sequences for d1r2ba_:

Sequence; same for both SEQRES and ATOM records:

>d1r2ba_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

Timeline for d1r2ba_:

• d1r2ba_ first appeared in SCOP 1.67
  
• d1r2ba_ appears in SCOP 1.69
  
• d1r2ba_ appears in SCOP 1.73
  
• d1r2ba_ appears in the current release, SCOPe 2.08