![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (2 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
![]() | Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries) |
![]() | Domain d1r29a_: 1r29 A: [96856] mutant |
PDB Entry: 1r29 (more details), 1.3 Å
SCOP Domain Sequences for d1r29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)} sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik as
Timeline for d1r29a_: