![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102956] (8 PDB entries) Uniprot P11349 |
![]() | Domain d1r27d_: 1r27 D: [96853] Other proteins in same PDB: d1r27a1, d1r27a2, d1r27c1, d1r27c2 complexed with f3s, mgd, mo, sf4 |
PDB Entry: 1r27 (more details), 2 Å
SCOPe Domain Sequences for d1r27d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r27d_ d.58.1.5 (D:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrel
Timeline for d1r27d_: