Lineage for d1r27d_ (1r27 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949380Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 2949385Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
    Uniprot P11349
  8. 2949392Domain d1r27d_: 1r27 D: [96853]
    Other proteins in same PDB: d1r27a1, d1r27a2, d1r27c1, d1r27c2
    complexed with f3s, mgd, mo, sf4

Details for d1r27d_

PDB Entry: 1r27 (more details), 2 Å

PDB Description: crystal structure of nargh complex
PDB Compounds: (D:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1r27d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r27d_ d.58.1.5 (D:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrel

SCOPe Domain Coordinates for d1r27d_:

Click to download the PDB-style file with coordinates for d1r27d_.
(The format of our PDB-style files is described here.)

Timeline for d1r27d_: