Lineage for d1r27b_ (1r27 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723475Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 723557Protein Respiratory nitrate reductase 1 beta chain [102955] (1 species)
  7. 723558Species Escherichia coli [TaxId:562] [102956] (6 PDB entries)
  8. 723564Domain d1r27b_: 1r27 B: [96850]
    Other proteins in same PDB: d1r27a1, d1r27a2, d1r27c1, d1r27c2

Details for d1r27b_

PDB Entry: 1r27 (more details), 2 Å

PDB Description: crystal structure of nargh complex
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOP Domain Sequences for d1r27b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r27b_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrel

SCOP Domain Coordinates for d1r27b_:

Click to download the PDB-style file with coordinates for d1r27b_.
(The format of our PDB-style files is described here.)

Timeline for d1r27b_: