![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101829] (7 PDB entries) Uniprot P09152 |
![]() | Domain d1r27a1: 1r27 A:1075-1246 [96848] Other proteins in same PDB: d1r27a2, d1r27b_, d1r27c2, d1r27d_ complexed with f3s, mgd, mo, sf4 |
PDB Entry: 1r27 (more details), 2 Å
SCOPe Domain Sequences for d1r27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r27a1 b.52.2.2 (A:1075-1246) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqesvk
Timeline for d1r27a1:
![]() Domains from other chains: (mouse over for more information) d1r27b_, d1r27c1, d1r27c2, d1r27d_ |