Lineage for d1r21a_ (1r21 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532659Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1532660Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1532694Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1532698Protein Antigen ki-67 [101626] (1 species)
  7. 1532699Species Human (Homo sapiens) [TaxId:9606] [101627] (2 PDB entries)
  8. 1532701Domain d1r21a_: 1r21 A: [96846]

Details for d1r21a_

PDB Entry: 1r21 (more details)

PDB Description: solution structure of human ki67 fha domain
PDB Compounds: (A:) Antigen Ki-67

SCOPe Domain Sequences for d1r21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r21a_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}
mwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeail
hnfsstnptqvngsvidepvrlkhgdvitiidrsfryene

SCOPe Domain Coordinates for d1r21a_:

Click to download the PDB-style file with coordinates for d1r21a_.
(The format of our PDB-style files is described here.)

Timeline for d1r21a_: