Lineage for d1r21a_ (1r21 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459700Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 459701Superfamily b.26.1: SMAD/FHA domain [49879] (3 families) (S)
    has a few short helices inserted in loops
  5. 459735Family b.26.1.2: FHA domain [49885] (7 proteins)
  6. 459736Protein Antigen ki-67 [101626] (1 species)
  7. 459737Species Human (Homo sapiens) [TaxId:9606] [101627] (1 PDB entry)
  8. 459738Domain d1r21a_: 1r21 A: [96846]

Details for d1r21a_

PDB Entry: 1r21 (more details)

PDB Description: solution structure of human ki67 fha domain

SCOP Domain Sequences for d1r21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r21a_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens)}
mwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeail
hnfsstnptqvngsvidepvrlkhgdvitiidrsfryene

SCOP Domain Coordinates for d1r21a_:

Click to download the PDB-style file with coordinates for d1r21a_.
(The format of our PDB-style files is described here.)

Timeline for d1r21a_: