Lineage for d1r21a_ (1r21 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. Protein Antigen ki-67 [101626] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101627] (2 PDB entries)
  8. Domain d1r21a_: 1r21 A: [96846]

Details for d1r21a_

PDB Entry: 1r21 (more details)

PDB Description: Solution Structure of human Ki67 FHA Domain
PDB Compounds: (A:) Antigen Ki-67

SCOPe Domain Sequences for d1r21a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r21a_ b.26.1.2 (A:) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]}
mwptrrlvtikrsgvdgphfplslstclfgrgiecdiriqlpvvskqhckieiheqeail
hnfsstnptqvngsvidepvrlkhgdvitiidrsfryene

SCOPe Domain Coordinates for d1r21a_ are not available.

Timeline for d1r21a_: