Lineage for d1r20d_ (1r20 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008573Protein Ecdysone receptor [101436] (1 species)
  7. 2008574Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [101437] (3 PDB entries)
  8. 2008577Domain d1r20d_: 1r20 D: [96845]
    Other proteins in same PDB: d1r20a_
    complexed with eph, hwg

Details for d1r20d_

PDB Entry: 1r20 (more details), 3 Å

PDB Description: Crystal structure of the ligand-binding domains of the heterodimer EcR/USP bound to the synthetic agonist BYI06830
PDB Compounds: (D:) Ecdysone receptor

SCOPe Domain Sequences for d1r20d_:

Sequence, based on SEQRES records: (download)

>d1r20d_ a.123.1.1 (D:) Ecdysone receptor {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vppltanqksliarlvyyqegyeqpseedlkrvtqtwqsdeddedsdmpfrqitemtilt
vqlivefakglpgfskisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrd
nyrkagmayviedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpslveeiqryyl
ntlrvyilnqnsasprsavifgkilgilteirtlgmqnsnmcislklknrklppfleeiw
dv

Sequence, based on observed residues (ATOM records): (download)

>d1r20d_ a.123.1.1 (D:) Ecdysone receptor {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vppltanqksliarlvyyqegyeqpseedlkrdmpfrqitemtiltvqlivefakglpgf
skisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayviedl
lhfcrcmysmmmdnvhyalltaivifsdrpgleqpslveeiqryylntlrvyilnqnsas
prsavifgkilgilteirtlgmqnsnmcislklknrklppfleeiwdv

SCOPe Domain Coordinates for d1r20d_:

Click to download the PDB-style file with coordinates for d1r20d_.
(The format of our PDB-style files is described here.)

Timeline for d1r20d_: