Lineage for d1r1za1 (1r1z A:43-277)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780347Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2780348Protein Carbohydrate-recognition domain of P58/ERGIC-53 [74905] (1 species)
  7. 2780349Species Norway rat (Rattus norvegicus) [TaxId:10116] [74906] (2 PDB entries)
  8. 2780351Domain d1r1za1: 1r1z A:43-277 [96840]
    Other proteins in same PDB: d1r1za2, d1r1zb2, d1r1zc2, d1r1zd2
    complexed with ca

Details for d1r1za1

PDB Entry: 1r1z (more details), 2.4 Å

PDB Description: The Crystal structure of the Carbohydrate recognition domain of the glycoprotein sorting receptor p58/ERGIC-53 reveals a novel metal binding site and conformational changes associated with calcium ion binding
PDB Compounds: (A:) ERGIC-53 protein

SCOPe Domain Sequences for d1r1za1:

Sequence, based on SEQRES records: (download)

>d1r1za1 b.29.1.13 (A:43-277) Carbohydrate-recognition domain of P58/ERGIC-53 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
agtqaelphrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvw
tktkaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsf
dndgkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltv
minngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsfltfqlte

Sequence, based on observed residues (ATOM records): (download)

>d1r1za1 b.29.1.13 (A:43-277) Carbohydrate-recognition domain of P58/ERGIC-53 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
agtqahrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtkt
kaafenwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdnd
gkknnpaivvvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvmin
ngftpdkndyefcakvenmviptqghfgisaatggladdhdvlsfltfqlte

SCOPe Domain Coordinates for d1r1za1:

Click to download the PDB-style file with coordinates for d1r1za1.
(The format of our PDB-style files is described here.)

Timeline for d1r1za1: