SCOP 1.75: Domain d1r1yc_: 1r1y C:

Lineage for d1r1yc_ (1r1y C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (20 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1r1yc_: 1r1y C: [96838]
   Other proteins in same PDB: d1r1yb_, d1r1yd_
   complexed with hem, so4; mutant

Details for d1r1yc_

PDB Entry: 1r1y, 1.8 Å

PDB Description: crystal structure of deoxy-human hemoglobin bassett at 1.8 angstrom

PDB Compounds: (C:) hemoglobin alpha chain

SCOP Domain Sequences for d1r1yc_:

Sequence; same for both SEQRES and ATOM records:

>d1r1yc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvapvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1r1yc_:

• d1r1yc_ first appeared in SCOP 1.67
  
• d1r1yc_ appears in SCOP 1.73
  
• d1r1yc_ appears in SCOPe 2.01
  
• d1r1yc_ appears in the current release, SCOPe 2.08