Lineage for d1r1yc_ (1r1y C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 530720Species Human (Homo sapiens) [TaxId:9606] [46487] (162 PDB entries)
  8. 530806Domain d1r1yc_: 1r1y C: [96838]
    Other proteins in same PDB: d1r1yb_, d1r1yd_
    complexed with hem, so4; mutant

Details for d1r1yc_

PDB Entry: 1r1y (more details), 1.8 Å

PDB Description: crystal structure of deoxy-human hemoglobin bassett at 1.8 angstrom

SCOP Domain Sequences for d1r1yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1yc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvapvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1r1yc_:

Click to download the PDB-style file with coordinates for d1r1yc_.
(The format of our PDB-style files is described here.)

Timeline for d1r1yc_: