Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Ferric-binding protein FbpA [53867] (7 species) |
Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries) Uniprot Q50964 23-331 |
Domain d1r1na_: 1r1n A: [96821] complexed with cn1, cnb, cnf has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1r1n (more details), 1.74 Å
SCOPe Domain Sequences for d1r1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1na_ c.94.1.1 (A:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]} ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat rlleqagmk
Timeline for d1r1na_: