Lineage for d1r1ma_ (1r1m A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2567239Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2567240Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 2567241Protein Outer membrane protein class 4, RmpM, C-terminal domain [103092] (1 species)
  7. 2567242Species Neisseria meningitidis [TaxId:487] [103093] (1 PDB entry)
  8. 2567243Domain d1r1ma_: 1r1m A: [96820]
    complexed with trs

Details for d1r1ma_

PDB Entry: 1r1m (more details), 1.9 Å

PDB Description: Structure of the OmpA-like domain of RmpM from Neisseria meningitidis
PDB Compounds: (A:) Outer membrane protein class 4

SCOPe Domain Sequences for d1r1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
pqyvdetislsaktlfgfdkdslraeaqdnlkvlaqrlsrtniqsvrveghtdfmgsdky
nqalserrayvvannlvsngvpvsrisavglgesqaqmtqvceaevaklgakvskakkre
aliaciepdrrvdvkirsiv

SCOPe Domain Coordinates for d1r1ma_:

Click to download the PDB-style file with coordinates for d1r1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1r1ma_: