Lineage for d1r1ka_ (1r1k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009346Protein Ultraspiracle protein, usp [48534] (2 species)
    the ortholog of RXRs in insects
  7. 2009354Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [63626] (4 PDB entries)
  8. 2009357Domain d1r1ka_: 1r1k A: [96818]
    Other proteins in same PDB: d1r1kd_
    complexed with eph, p1a

Details for d1r1ka_

PDB Entry: 1r1k (more details), 2.9 Å

PDB Description: Crystal structure of the ligand-binding domains of the heterodimer EcR/USP bound to ponasterone A
PDB Compounds: (A:) ultraspiracle protein

SCOPe Domain Sequences for d1r1ka_:

Sequence, based on SEQRES records: (download)

>d1r1ka_ a.123.1.1 (A:) Ultraspiracle protein, usp {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwa
rdiphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlmc
lmpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglkn
rqevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadt
siagyirdalr

Sequence, based on observed residues (ATOM records): (download)

>d1r1ka_ a.123.1.1 (A:) Ultraspiracle protein, usp {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
vqelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwa
rdiphfsqlemedqillikgswnelllfaiawrsmeflterttsppqlmclmpgmtlhrn
salqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrek
mflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdal
r

SCOPe Domain Coordinates for d1r1ka_:

Click to download the PDB-style file with coordinates for d1r1ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r1ka_: