Lineage for d1r1fa_ (1r1f A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427413Superfamily g.3.3: Cyclotides [57038] (4 families) (S)
    macrocyclic plant knottins closed with the formation of an Asn-Gly peptide
  5. 427432Family g.3.3.4: Palicourein [103526] (1 protein)
  6. 427433Protein Palicourein [103527] (1 species)
  7. 427434Species Palicourea condensata [TaxId:272141] [103528] (1 PDB entry)
  8. 427435Domain d1r1fa_: 1r1f A: [96815]
    by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly35 and ends at Asn34

Details for d1r1fa_

PDB Entry: 1r1f (more details)

PDB Description: solution structure of the cyclotide palicourein: implications for the development of pharmaceutical and agricultural applications

SCOP Domain Sequences for d1r1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1fa_ g.3.3.4 (A:) Palicourein {Palicourea condensata}
tfcgetcrvipvctysaalgctcddrsdglckrngdp

SCOP Domain Coordinates for d1r1fa_:

Click to download the PDB-style file with coordinates for d1r1fa_.
(The format of our PDB-style files is described here.)

Timeline for d1r1fa_: