![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.3: Cyclotides [57038] (4 families) ![]() macrocyclic plant knottins closed with the formation of an Asn-Gly peptide |
![]() | Family g.3.3.4: Palicourein [103526] (1 protein) automatically mapped to Pfam PF03784 |
![]() | Protein Palicourein [103527] (1 species) |
![]() | Species Palicourea condensata [TaxId:272141] [103528] (1 PDB entry) |
![]() | Domain d1r1fa_: 1r1f A: [96815] by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly35 and ends at Asn34 |
PDB Entry: 1r1f (more details)
SCOPe Domain Sequences for d1r1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1fa_ g.3.3.4 (A:) Palicourein {Palicourea condensata [TaxId: 272141]} tfcgetcrvipvctysaalgctcddrsdglckrngdp
Timeline for d1r1fa_: