SCOPe 2.08: Domain d1r1fa_: 1r1f A:

Lineage for d1r1fa_ (1r1f A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.3: Cyclotides [57038] (4 families)
   macrocyclic plant knottins closed with the formation of an Asn-Gly peptide

5. Family g.3.3.4: Palicourein [103526] (1 protein)
   automatically mapped to Pfam PF03784

6. Protein Palicourein [103527] (1 species)

7. Species Palicourea condensata [TaxId:272141] [103528] (1 PDB entry)

8. Domain d1r1fa_: 1r1f A: [96815]
   by homology with the Kalata B1 linear precursor, the mature protein sequence probably begins at Gly35 and ends at Asn34

Details for d1r1fa_

PDB Entry: 1r1f

PDB Description: solution structure of the cyclotide palicourein: implications for the development of pharmaceutical and agricultural applications

PDB Compounds: (A:) Palicourein

SCOPe Domain Sequences for d1r1fa_:

Sequence; same for both SEQRES and ATOM records:

>d1r1fa_ g.3.3.4 (A:) Palicourein {Palicourea condensata [TaxId: 272141]}
tfcgetcrvipvctysaalgctcddrsdglckrngdp

Timeline for d1r1fa_:

• d1r1fa_ first appeared in SCOP 1.67
  
• d1r1fa_ appears in SCOPe 2.07