SCOPe 2.05: Domain d1r1db_: 1r1d B:

Lineage for d1r1db_ (1r1d B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.29: Carboxylesterase/lipase [102623] (1 protein)
   automatically mapped to Pfam PF12697

6. Protein Carboxylesterase Est [102624] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [102625] (2 PDB entries)
   Uniprot Q06174

8. Domain d1r1db_: 1r1d B: [96814]
   complexed with epe

Details for d1r1db_

PDB Entry: 1r1d, 2 Å

PDB Description: structure of a carboxylesterase from bacillus stearothermophilus

PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d1r1db_:

Sequence; same for both SEQRES and ATOM records:

>d1r1db_ c.69.1.29 (B:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}
ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt
fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
dw

Timeline for d1r1db_:

• d1r1db_ first appeared in SCOP 1.67
  
• d1r1db_ appears in SCOPe 2.04
  
• d1r1db_ appears in SCOPe 2.06
  
• d1r1db_ appears in the current release, SCOPe 2.08