Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.29: Carboxylesterase/lipase [102623] (1 protein) automatically mapped to Pfam PF12697 |
Protein Carboxylesterase Est [102624] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [102625] (2 PDB entries) Uniprot Q06174 |
Domain d1r1db_: 1r1d B: [96814] complexed with epe |
PDB Entry: 1r1d (more details), 2 Å
SCOPe Domain Sequences for d1r1db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1db_ c.69.1.29 (B:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl dw
Timeline for d1r1db_: