SCOP 1.67: Domain d1r1db_: 1r1d B:

Lineage for d1r1db_ (1r1d B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.29: Carboxylesterase [102623] (1 protein)

6. Protein Carboxylesterase [102624] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [102625] (1 PDB entry)

8. Domain d1r1db_: 1r1d B: [96814]
   complexed with epe

Details for d1r1db_

PDB Entry: 1r1d, 2 Å

PDB Description: structure of a carboxylesterase from bacillus stearothermophilus

SCOP Domain Sequences for d1r1db_:

Sequence; same for both SEQRES and ATOM records:

>d1r1db_ c.69.1.29 (B:) Carboxylesterase {Bacillus stearothermophilus}
ppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtg
pddwwqdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyiksee
tmyegvleyareykkregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyapt
fvvqarhdeminpdsaniiyneiespvkqikwyeqsghvitldqekdqlhediyaflesl
dw

Timeline for d1r1db_:

• d1r1db_ is new in SCOP 1.67
  
• d1r1db_ appears in SCOP 1.69
  
• d1r1db_ appears in the current release, SCOPe 2.08