Lineage for d1r19d1 (1r19 D:277-424)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659391Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 659481Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
    duplication: contains two differently decorated domains of this fold
  6. 659486Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)
  7. 659487Species Staphylococcus epidermidis [TaxId:1282] [101551] (2 PDB entries)
  8. 659498Domain d1r19d1: 1r19 D:277-424 [96807]

Details for d1r19d1

PDB Entry: 1r19 (more details), 3.51 Å

PDB Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (Apo structure)
PDB Compounds: (D:) fibrinogen-binding protein SdrG

SCOP Domain Sequences for d1r19d1:

Sequence, based on SEQRES records: (download)

>d1r19d1 b.2.3.4 (D:277-424) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidkntv
psdltdsfaipkikdnsgeiiatgtydntnkqitytftdyvdkyenikahlkltsyidks
kvpnnntkldveyktalssvnktitvey

Sequence, based on observed residues (ATOM records): (download)

>d1r19d1 b.2.3.4 (D:277-424) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidkntv
psdltdsipkikdeiiatgtydntnkqityttdyvdnikahlkltsyidkskvpnnntkl
dveyktalssvnktitvey

SCOP Domain Coordinates for d1r19d1:

Click to download the PDB-style file with coordinates for d1r19d1.
(The format of our PDB-style files is described here.)

Timeline for d1r19d1: