Lineage for d1r19b1 (1r19 B:277-424)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368306Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 368381Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
    duplication: contains two differently decorated domains of this fold
  6. 368386Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)
  7. 368387Species Staphylococcus epidermidis [TaxId:1282] [101551] (2 PDB entries)
  8. 368394Domain d1r19b1: 1r19 B:277-424 [96803]

Details for d1r19b1

PDB Entry: 1r19 (more details), 3.51 Å

PDB Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (Apo structure)

SCOP Domain Sequences for d1r19b1:

Sequence, based on SEQRES records: (download)

>d1r19b1 b.2.3.4 (B:277-424) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis}
snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgdtmtvnidkntv
psdltdsfaipkikdnsgeiiatgtydntnkqitytftdyvdkyenikahlkltsyidks
kvpnnntkldveyktalssvnktitvey

Sequence, based on observed residues (ATOM records): (download)

>d1r19b1 b.2.3.4 (B:277-424) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis}
snvnhlikvtdqsitegyddsdgiikahdaenliydvtfevddkvksgtmtvnidkntvp
sdltdsfaipkikdnsgeiiatgtydntnkqitytftyenikahlkltsyidkskvpnnn
tkldveyktalssvnktitvey

SCOP Domain Coordinates for d1r19b1:

Click to download the PDB-style file with coordinates for d1r19b1.
(The format of our PDB-style files is described here.)

Timeline for d1r19b1: