Lineage for d1r19a2 (1r19 A:425-580)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
    duplication: contains two differently decorated domains of this fold
  6. Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)
  7. Species Staphylococcus epidermidis [TaxId:1282] [101551] (3 PDB entries)
  8. Domain d1r19a2: 1r19 A:425-580 [96802]

Details for d1r19a2

PDB Entry: 1r19 (more details), 3.51 Å

PDB Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (Apo structure)
PDB Compounds: (A:) fibrinogen-binding protein SdrG

SCOPe Domain Sequences for d1r19a2:

Sequence, based on SEQRES records: (download)

>d1r19a2 b.2.3.4 (A:425-580) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst
iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikvisk
ydpnkddyttiqqtvtmqttineytgefrtasydnt

Sequence, based on observed residues (ATOM records): (download)

>d1r19a2 b.2.3.4 (A:425-580) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst
iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgndvninfgnidspyiikviskyd
ptiqqtvtmqttineytgefrtasydnt

SCOPe Domain Coordinates for d1r19a2 are not available.

Timeline for d1r19a2:

Domains from same chain:
(mouse over for more information)
d1r19a1
Domains from other chains:
(mouse over for more information)
d1r19b1, d1r19b2, d1r19c1, d1r19c2, d1r19d1, d1r19d2