SCOP 1.67: Domain d1r17b2: 1r17 B:425-595

Lineage for d1r17b2 (1r17 B:425-595)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (5 families)

5. Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
   duplication: contains two differently decorated domains of this fold

6. Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)

7. Species Staphylococcus epidermidis [TaxId:1282] [101551] (2 PDB entries)

8. Domain d1r17b2: 1r17 B:425-595 [96799]
   complexed with fibrinopeptide B
   complexed with ca

Details for d1r17b2

PDB Entry: 1r17, 1.86 Å

PDB Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (adhesin-ligand complex)

SCOP Domain Sequences for d1r17b2:

Sequence; same for both SEQRES and ATOM records:

>d1r17b2 b.2.3.4 (B:425-595) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis}
qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst
iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikvisk
ydpnkddyttiqqtvtmqttineytgefrtasydntiafstssgqgqgdlp

Timeline for d1r17b2:

• d1r17b2 is new in SCOP 1.67
  
• d1r17b2 appears in SCOP 1.69
  
• d1r17b2 appears in the current release, SCOPe 2.08