![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins) duplication: contains two differently decorated domains of this fold |
![]() | Protein Fibrinogen-binding adhesin SdrG [101550] (1 species) |
![]() | Species Staphylococcus epidermidis [TaxId:1282] [101551] (3 PDB entries) |
![]() | Domain d1r17b2: 1r17 B:425-595 [96799] complexed with fibrinopeptide B complexed with ca |
PDB Entry: 1r17 (more details), 1.86 Å
SCOPe Domain Sequences for d1r17b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r17b2 b.2.3.4 (B:425-595) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]} qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikvisk ydpnkddyttiqqtvtmqttineytgefrtasydntiafstssgqgqgdlp
Timeline for d1r17b2: