Lineage for d1r17b2 (1r17 B:425-595)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767747Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
    duplication: contains two differently decorated domains of this fold
  6. 2767752Protein Fibrinogen-binding adhesin SdrG [101550] (1 species)
  7. 2767753Species Staphylococcus epidermidis [TaxId:1282] [101551] (3 PDB entries)
  8. 2767757Domain d1r17b2: 1r17 B:425-595 [96799]
    complexed with fibrinopeptide B
    complexed with ca

Details for d1r17b2

PDB Entry: 1r17 (more details), 1.86 Å

PDB Description: Crystal Structure Analysis of S.epidermidis adhesin SdrG binding to Fibrinogen (adhesin-ligand complex)
PDB Compounds: (B:) fibrinogen-binding protein SdrG

SCOPe Domain Sequences for d1r17b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r17b2 b.2.3.4 (B:425-595) Fibrinogen-binding adhesin SdrG {Staphylococcus epidermidis [TaxId: 1282]}
qkpnenrtanlqsmftnidtknhtveqtiyinplrysaketnvnisgngdegstiiddst
iikvykvgdnqnlpdsnriydyseyedvtnddyaqlgnnndvninfgnidspyiikvisk
ydpnkddyttiqqtvtmqttineytgefrtasydntiafstssgqgqgdlp

SCOPe Domain Coordinates for d1r17b2:

Click to download the PDB-style file with coordinates for d1r17b2.
(The format of our PDB-style files is described here.)

Timeline for d1r17b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r17b1