![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins) contains extra N-terminal all-alpha subdomain |
![]() | Protein ADP ribosyl cyclase [56631] (4 species) |
![]() | Species California sea hare (Aplysia californica) [TaxId:6500] [56632] (5 PDB entries) |
![]() | Domain d1r15h_: 1r15 H: [96793] complexed with n, nca |
PDB Entry: 1r15 (more details), 2.4 Å
SCOPe Domain Sequences for d1r15h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r15h_ c.23.14.3 (H:) ADP ribosyl cyclase {California sea hare (Aplysia californica) [TaxId: 6500]} ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs dnpnarecrla
Timeline for d1r15h_: