Lineage for d1r15d_ (1r15 D:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424067Fold e.4: ADP ribosyl cyclase-like [56628] (1 superfamily)
    contains a cluster of helices and an alpha/beta domain
  4. 424068Superfamily e.4.1: ADP ribosyl cyclase-like [56629] (1 family) (S)
  5. 424069Family e.4.1.1: ADP ribosyl cyclase-like [56630] (2 proteins)
  6. 424070Protein ADP ribosyl cyclase [56631] (1 species)
  7. 424071Species Sea hare (Aplysia californica) [TaxId:6500] [56632] (5 PDB entries)
  8. 424083Domain d1r15d_: 1r15 D: [96789]

Details for d1r15d_

PDB Entry: 1r15 (more details), 2.4 Å

PDB Description: Aplysia ADP ribosyl cyclase with bound nicotinamide and R5P

SCOP Domain Sequences for d1r15d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r15d_ e.4.1.1 (D:) ADP ribosyl cyclase {Sea hare (Aplysia californica)}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOP Domain Coordinates for d1r15d_:

Click to download the PDB-style file with coordinates for d1r15d_.
(The format of our PDB-style files is described here.)

Timeline for d1r15d_: