Lineage for d1r15b_ (1r15 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840000Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1840044Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 1840045Protein ADP ribosyl cyclase [56631] (4 species)
  7. 1840046Species California sea hare (Aplysia californica) [TaxId:6500] [56632] (5 PDB entries)
  8. 1840056Domain d1r15b_: 1r15 B: [96787]
    complexed with n, nca

Details for d1r15b_

PDB Entry: 1r15 (more details), 2.4 Å

PDB Description: Aplysia ADP ribosyl cyclase with bound nicotinamide and R5P
PDB Compounds: (B:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d1r15b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r15b_ c.23.14.3 (B:) ADP ribosyl cyclase {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOPe Domain Coordinates for d1r15b_:

Click to download the PDB-style file with coordinates for d1r15b_.
(The format of our PDB-style files is described here.)

Timeline for d1r15b_: