SCOP 1.73: Domain d1r14a1: 1r14 A:110-228

Lineage for d1r14a1 (1r14 A:110-228)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (2 PDB entries)

8. Domain d1r14a1: 1r14 A:110-228 [96784]
   Other proteins in same PDB: d1r14a2
   complexed with mes, sm; mutant

Details for d1r14a1

PDB Entry: 1r14, 2.5 Å

PDB Description: carbohydrate recognition and neck domains of surfactant protein a (sp- a) containing samarium

PDB Compounds: (A:) Pulmonary surfactant-associated protein A

SCOP Domain Sequences for d1r14a1:

Sequence; same for both SEQRES and ATOM records:

>d1r14a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef

Timeline for d1r14a1:

• d1r14a1 first appeared in SCOP 1.67
  
• d1r14a1 appears in SCOP 1.71
  
• d1r14a1 appears in SCOP 1.75
  
• d1r14a1 appears in the current release, SCOPe 2.08