SCOP 1.67: Domain d1r11b4: 1r11 B:140-214

Lineage for d1r11b4 (1r11 B:140-214)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family)

5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [103074] (3 PDB entries)

8. Domain d1r11b4: 1r11 B:140-214 [96779]
   Other proteins in same PDB: d1r11a1, d1r11a2, d1r11b1, d1r11b2

Details for d1r11b4

PDB Entry: 1r11, 2.7 Å

PDB Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21 space group

SCOP Domain Sequences for d1r11b4:

Sequence; same for both SEQRES and ATOM records:

>d1r11b4 d.75.1.1 (B:140-214) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeon Archaeoglobus fulgidus}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

Timeline for d1r11b4:

• d1r11b4 is new in SCOP 1.67
  
• d1r11b4 appears in SCOP 1.69
  
• d1r11b4 appears in the current release, SCOPe 2.08