Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) |
Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins) |
Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species) duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats |
Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries) |
Domain d1r11b3: 1r11 B:3-60 [96778] Other proteins in same PDB: d1r11a1, d1r11a2, d1r11b1, d1r11b2 |
PDB Entry: 1r11 (more details), 2.7 Å
SCOPe Domain Sequences for d1r11b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r11b3 d.75.1.1 (B:3-60) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]} ggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
Timeline for d1r11b3:
View in 3D Domains from other chains: (mouse over for more information) d1r11a1, d1r11a2, d1r11a3, d1r11a4 |