SCOP 1.67: Domain d1r11b1: 1r11 B:61-139

Lineage for d1r11b1 (1r11 B:61-139)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family)

5. Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (2 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102478] (3 PDB entries)

8. Domain d1r11b1: 1r11 B:61-139 [96776]
   Other proteins in same PDB: d1r11a3, d1r11a4, d1r11b3, d1r11b4

Details for d1r11b1

PDB Entry: 1r11, 2.7 Å

PDB Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21 space group

SCOP Domain Sequences for d1r11b1:

Sequence; same for both SEQRES and ATOM records:

>d1r11b1 c.52.2.1 (B:61-139) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeon Archaeoglobus fulgidus}
edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
vvdeeseityfrvyepdmm

Timeline for d1r11b1:

• d1r11b1 is new in SCOP 1.67
  
• d1r11b1 appears in SCOP 1.69
  
• d1r11b1 appears in the current release, SCOPe 2.08