Lineage for d1r0wc1 (1r0w C:389-670)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2112801Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2112821Species Mouse (Mus musculus) [TaxId:10090] [102379] (9 PDB entries)
    Uniprot P26361 390-670
  8. 2112828Domain d1r0wc1: 1r0w C:389-670 [96756]
    Other proteins in same PDB: d1r0wc2
    complexed with acy

Details for d1r0wc1

PDB Entry: 1r0w (more details), 2.2 Å

PDB Description: Cystic fibrosis transmembrane conductance regulator (CFTR) nucleotide-binding domain one (NBD1) apo
PDB Compounds: (C:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d1r0wc1:

Sequence, based on SEQRES records: (download)

>d1r0wc1 c.37.1.12 (C:389-670) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninlni
ekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniif
gvsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadl
ylldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfyg
tfselqslrpdfssklmgydtfdqfteerrssiltetlrrfs

Sequence, based on observed residues (ATOM records): (download)

>d1r0wc1 c.37.1.12 (C:389-670) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ttgiimenvtafweegfgellekvqfshlclvgnpvlkninlniekgemlaitgstgsgk
tsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniifgvsydeyryksvvkac
qlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvftee
qvfescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfsskl
mgydtfdqfteerrssiltetlrrfs

SCOPe Domain Coordinates for d1r0wc1:

Click to download the PDB-style file with coordinates for d1r0wc1.
(The format of our PDB-style files is described here.)

Timeline for d1r0wc1: