SCOPe 2.07: Domain d1r0vc3: 1r0v C:140-214

Lineage for d1r0vc3 (1r0v C:140-214)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family)

5. Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)

6. Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
   duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats

7. Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)

8. Domain d1r0vc3: 1r0v C:140-214 [96750]
   Other proteins in same PDB: d1r0va1, d1r0va2, d1r0vb1, d1r0vb2, d1r0vc1, d1r0vc2, d1r0vd1, d1r0vd2

Details for d1r0vc3

PDB Entry: 1r0v, 2 Å

PDB Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21212 space group

PDB Compounds: (C:) tRNA-intron endonuclease

SCOPe Domain Sequences for d1r0vc3:

Sequence; same for both SEQRES and ATOM records:

>d1r0vc3 d.75.1.1 (C:140-214) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

Timeline for d1r0vc3:

• d1r0vc3 first appeared in SCOP 1.67
  
• d1r0vc3 appears in SCOPe 2.06
  
• d1r0vc3 appears in the current release, SCOPe 2.08