Lineage for d1r0vb1 (1r0v B:62-139)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397233Superfamily c.52.2: tRNA-intron endonuclease catalytic domain-like [53032] (1 family) (S)
  5. 397234Family c.52.2.1: tRNA-intron endonuclease catalytic domain-like [53033] (2 proteins)
  6. 397235Protein Dimeric tRNA splicing endonuclease, domains 2 and 4 [102477] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 397236Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102478] (3 PDB entries)
  8. 397239Domain d1r0vb1: 1r0v B:62-139 [96745]
    Other proteins in same PDB: d1r0va3, d1r0vb3, d1r0vc3, d1r0vd3

Details for d1r0vb1

PDB Entry: 1r0v (more details), 2 Å

PDB Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21212 space group

SCOP Domain Sequences for d1r0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0vb1 c.52.2.1 (B:62-139) Dimeric tRNA splicing endonuclease, domains 2 and 4 {Archaeon Archaeoglobus fulgidus}
dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
vdeeseityfrvyepdmm

SCOP Domain Coordinates for d1r0vb1:

Click to download the PDB-style file with coordinates for d1r0vb1.
(The format of our PDB-style files is described here.)

Timeline for d1r0vb1: