Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.5: Hypothetical protein YwiB [101866] (1 protein) bacterial proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF09148 |
Protein Hypothetical protein YwiB [101867] (1 species) |
Species Bacillus subtilis [TaxId:1423] [101868] (1 PDB entry) |
Domain d1r0ua_: 1r0u A: [96741] structural genomics complexed with gol |
PDB Entry: 1r0u (more details), 1.75 Å
SCOPe Domain Sequences for d1r0ua_:
Sequence, based on SEQRES records: (download)
>d1r0ua_ b.60.1.5 (A:) Hypothetical protein YwiB {Bacillus subtilis [TaxId: 1423]} gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri siaydmhvgdeqehlhnmtityeggt
>d1r0ua_ b.60.1.5 (A:) Hypothetical protein YwiB {Bacillus subtilis [TaxId: 1423]} gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri siaydmhvghlhnmtityeggt
Timeline for d1r0ua_: