Lineage for d1r0ua_ (1r0u A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2415024Family b.60.1.5: Hypothetical protein YwiB [101866] (1 protein)
    bacterial proteins with a fatty acid binding protein-like fold
    automatically mapped to Pfam PF09148
  6. 2415025Protein Hypothetical protein YwiB [101867] (1 species)
  7. 2415026Species Bacillus subtilis [TaxId:1423] [101868] (1 PDB entry)
  8. 2415027Domain d1r0ua_: 1r0u A: [96741]
    structural genomics
    complexed with gol

Details for d1r0ua_

PDB Entry: 1r0u (more details), 1.75 Å

PDB Description: Crystal structure of ywiB protein from Bacillus subtilis
PDB Compounds: (A:) protein ywiB

SCOPe Domain Sequences for d1r0ua_:

Sequence, based on SEQRES records: (download)

>d1r0ua_ b.60.1.5 (A:) Hypothetical protein YwiB {Bacillus subtilis [TaxId: 1423]}
gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
siaydmhvgdeqehlhnmtityeggt

Sequence, based on observed residues (ATOM records): (download)

>d1r0ua_ b.60.1.5 (A:) Hypothetical protein YwiB {Bacillus subtilis [TaxId: 1423]}
gfqsnamkqetpitlhvksvieddgnqeviefrttgfyyvkqnkvylsyyeehdlgkvkt
ivkvsegevlvmrsgavkmnqrfvtgastiakykmsfgelelktstksiqsdldeekgri
siaydmhvghlhnmtityeggt

SCOPe Domain Coordinates for d1r0ua_:

Click to download the PDB-style file with coordinates for d1r0ua_.
(The format of our PDB-style files is described here.)

Timeline for d1r0ua_: