Lineage for d1r0pa_ (1r0p A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543916Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543917Species Human (Homo sapiens) [TaxId:9606] [103301] (57 PDB entries)
  8. 2543945Domain d1r0pa_: 1r0p A: [96734]
    complexed with ksa

Details for d1r0pa_

PDB Entry: 1r0p (more details), 1.8 Å

PDB Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with the microbial alkaloid k-252a
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d1r0pa_:

Sequence, based on SEQRES records: (download)

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
rnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardm
ydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehy
vhvnatyvnvk

Sequence, based on observed residues (ATOM records): (download)

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavksln
ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
hnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmydke
fdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypitvyllqg
rrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnv
k

SCOPe Domain Coordinates for d1r0pa_:

Click to download the PDB-style file with coordinates for d1r0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1r0pa_: