Lineage for d1r0oa_ (1r0o A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. Protein Ultraspiracle protein [103603] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103604] (1 PDB entry)
  8. Domain d1r0oa_: 1r0o A: [96732]
    Other proteins in same PDB: d1r0ob_
    protein/DNA complex; complexed with zn

Details for d1r0oa_

PDB Entry: 1r0o (more details), 2.24 Å

PDB Description: Crystal Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex
PDB Compounds: (A:) ultraspiracle protein

SCOPe Domain Sequences for d1r0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0oa_ g.39.1.2 (A:) Ultraspiracle protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hlcsicgdrasgkhygvyscegckgffkrtvrkdltyacrenrnciidkrqrnrcqycry
qkcltcgmkreavqee

SCOPe Domain Coordinates for d1r0oa_ are not available.

Timeline for d1r0oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r0ob_