SCOPe 2.07: Domain d1r0nb_: 1r0n B:

Lineage for d1r0nb_ (1r0n B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Ecdysone receptor DNA-binding domain [103601] (1 species)
7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103602] (2 PDB entries)

8. Domain d1r0nb_: 1r0n B: [96731]
   Other proteins in same PDB: d1r0na1, d1r0na2
   protein/DNA complex; complexed with zn

Details for d1r0nb_

PDB Entry: 1r0n, 2.6 Å

PDB Description: Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex

PDB Compounds: (B:) Ecdysone receptor

SCOPe Domain Sequences for d1r0nb_:

Sequence; same for both SEQRES and ATOM records:

>d1r0nb_ g.39.1.2 (B:) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
elclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecrl
kkclavgmrpecvvpenqcamkrrek

Timeline for d1r0nb_:

• d1r0nb_ first appeared in SCOP 1.67
  
• d1r0nb_ appears in SCOPe 2.06
  
• d1r0nb_ appears in the current release, SCOPe 2.08