Lineage for d1r0nb_ (1r0n B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. Protein Ecdysone receptor DNA-binding domain [103601] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103602] (2 PDB entries)
  8. 2640326Domain d1r0nb_: 1r0n B: [96731]
    Other proteins in same PDB: d1r0na1, d1r0na2
    protein/DNA complex; complexed with zn

Details for d1r0nb_

PDB Entry: 1r0n (more details), 2.6 Å

PDB Description: Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex
PDB Compounds: (B:) Ecdysone receptor

SCOPe Domain Sequences for d1r0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0nb_ g.39.1.2 (B:) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
elclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecrl
kkclavgmrpecvvpenqcamkrrek

SCOPe Domain Coordinates for d1r0nb_:

Click to download the PDB-style file with coordinates for d1r0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1r0nb_: