Class g: Small proteins [56992] (79 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) |
Family g.39.1.2: Nuclear receptor [57721] (12 proteins) duplication: two zinc-binding motifs |
Protein Ecdysone receptor DNA-binding domain [103601] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103602] (2 PDB entries) |
Domain d1r0nb_: 1r0n B: [96731] Other proteins in same PDB: d1r0na_ complexed with zn |
PDB Entry: 1r0n (more details), 2.6 Å
SCOP Domain Sequences for d1r0nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0nb_ g.39.1.2 (B:) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster)} elclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecrl kkclavgmrpecvvpenqcamkrrek
Timeline for d1r0nb_: