Lineage for d1r0nb_ (1r0n B:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523848Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 523849Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families) (S)
  5. 523863Family g.39.1.2: Nuclear receptor [57721] (12 proteins)
    duplication: two zinc-binding motifs
  6. 523868Protein Ecdysone receptor DNA-binding domain [103601] (1 species)
  7. 523869Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103602] (2 PDB entries)
  8. 523871Domain d1r0nb_: 1r0n B: [96731]
    Other proteins in same PDB: d1r0na_

Details for d1r0nb_

PDB Entry: 1r0n (more details), 2.6 Å

PDB Description: Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex

SCOP Domain Sequences for d1r0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0nb_ g.39.1.2 (B:) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster)}
elclvcgdrasgyhynaltcegckgffrrsvtksavycckfgracemdmymrrkcqecrl
kkclavgmrpecvvpenqcamkrrek

SCOP Domain Coordinates for d1r0nb_:

Click to download the PDB-style file with coordinates for d1r0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1r0nb_: