Lineage for d1r0na1 (1r0n A:99-172)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640372Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 2640373Species Human (Homo sapiens) [TaxId:9606] [57723] (5 PDB entries)
  8. 2640380Domain d1r0na1: 1r0n A:99-172 [96730]
    Other proteins in same PDB: d1r0na2, d1r0nb_
    protein/DNA complex; complexed with zn

Details for d1r0na1

PDB Entry: 1r0n (more details), 2.6 Å

PDB Description: Crystal Structure of Heterodimeric Ecdsyone receptor DNA binding complex
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1r0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0na1 g.39.1.2 (A:99-172) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
hicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycry
qkclamgmkreavq

SCOPe Domain Coordinates for d1r0na1:

Click to download the PDB-style file with coordinates for d1r0na1.
(The format of our PDB-style files is described here.)

Timeline for d1r0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r0na2
View in 3D
Domains from other chains:
(mouse over for more information)
d1r0nb_