Lineage for d1r0ga_ (1r0g A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245023Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1245024Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1245033Protein Rubredoxin [57804] (8 species)
  7. 1245034Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. 1245046Domain d1r0ga_: 1r0g A: [96726]
    mercury-substituted
    complexed with hg

Details for d1r0ga_

PDB Entry: 1r0g (more details), 1.6 Å

PDB Description: mercury-substituted rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1r0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ga_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOPe Domain Coordinates for d1r0ga_:

Click to download the PDB-style file with coordinates for d1r0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r0ga_: