Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1r0ga_ (1r0g A:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Clostridium pasteurianum [TaxId:1501] [57808] (23 PDB entries)
    Uniprot P00268
  8. Domain d1r0ga_: 1r0g A: [96726]
    mercury-substituted
    complexed with hg

Details for d1r0ga_

PDB Entry: 1r0g (more details)
PDB Description: mercury-substituted rubredoxin
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d1r0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ga_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}
mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve

SCOP Domain Coordinates for d1r0ga_:

Click to download the PDB-style file with coordinates for d1r0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1r0ga_:

d1r0ga_ appears in SCOP 1.75A


d1r0ga_
(click for larger image)


d1r0ga_ in context of chain


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu