SCOPe 2.04: Domain d1r05b_: 1r05 B:

Lineage for d1r05b_ (1r05 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (1 family)
   dimer of two identical helix-loop-helix subunits

5. Family a.38.1.1: HLH, helix-loop-helix DNA-binding domain [47460] (8 proteins)

6. Protein Max protein [47461] (2 species)
   BHLHZ region; contains leucine-zipper motif

7. Species Human (Homo sapiens) [TaxId:9606] [47462] (4 PDB entries)

8. Domain d1r05b_: 1r05 B: [96724]

Details for d1r05b_

PDB Entry: 1r05

PDB Description: solution structure of max b-hlh-lz

PDB Compounds: (B:) max protein

SCOPe Domain Sequences for d1r05b_:

Sequence; same for both SEQRES and ATOM records:

>d1r05b_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]}
madkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrkvht
lqqdiddlkrqnalleqqvralegsgc

Timeline for d1r05b_:

• d1r05b_ first appeared in SCOP 1.67
  
• d1r05b_ appears in SCOPe 2.03
  
• d1r05b_ appears in SCOPe 2.05
  
• d1r05b_ appears in the current release, SCOPe 2.08, called d1r05b1